7d72/1/1:E/1:G

Sequences

>7d72-a1-m1-cE (length=360) [Search sequence]

MKALILVGGYGTRLRPLTLSTPKPLVDFCNKPILLHQVEALAAAGVDHVILAVSYMSQVL
EKEMKAQEQRLGIRISMSHEEEPLGTAGPLALARDLLSETADPFFVLNSDVICDFPFQAM
VQFHRHHGQEGSILVTKVEEPSKYGVVVCEADTGRIHRFVEKPQVFVSNKINAGMYILSP
AVLQRIQLQPTSIEKEVFPIMAKEGQLYAMELQGFWMDIGQPKDFLTGMCLFLQSLRQKQ
PERLCSGPGIVGNVLVDPSARIGQNCSIGPNVSLGPGVVVEDGVCIRRCTVLRDARIRSH
SWLESCIVGWRCRVGQWVRMENVTVLGEDVIVNDELYLNGASVLPHKSIGESVPEPRIIM

>7d72-a1-m1-cG (length=360) [Search sequence]

Structure information

PDB ID	7d72 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Cryo-EM structures of human GMPPA/GMPPB complex bound to GDP-Mannose
Assembly ID	1
Resolution	3.4Å
Method of structure determination	ELECTRON MICROSCOPY
Number of inter-chain contacts	34
Sequence identity between the two chains	1.0
PubMed citation	33986552

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	E	G
UniProt accession	Q9Y5P6	Q9Y5P6
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:7d72E	BioLiP:7d72G

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	7d72-a1-m1-cE_7d72-a1-m1-cG.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	7d72-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	7d72/1/1:J/1:L 7d73/1/1:E/1:G 7d73/1/1:J/1:L 7d74/1/1:G/1:E 7d74/1/1:J/1:L
Other dimers with similar sequences but different poses	7d74/1/1:K/1:L 7d72/1/1:E/1:F 7d72/1/1:G/1:H 7d72/1/1:I/1:J 7d72/1/1:K/1:L 7d73/1/1:F/1:E 7d73/1/1:G/1:H 7d73/1/1:I/1:J 7d73/1/1:K/1:L 7d74/1/1:E/1:F 7d74/1/1:G/1:H 7d74/1/1:I/1:J