7d8j/1/1:A/2:A

Sequences
>7d8j-a1-m1-cA (length=112) [Search sequence]
MLNRVVLVGRLTKDPELRSTPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAEN
VKNYLSKGSLAGVDGRLQTRNYENKDGQRVFVTEVVADSVQFLEPKNNNQQQ
>7d8j-a1-m2-cA (length=112) [Search sequence]
MLNRVVLVGRLTKDPELRSTPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAEN
VKNYLSKGSLAGVDGRLQTRNYENKDGQRVFVTEVVADSVQFLEPKNNNQQQ
Structure information
PDB ID 7d8j (database links: RCSB PDB PDBe PDBj PDBsum)
Title S. aureus SsbB with 5-FU
Assembly ID 1
Resolution 2.88Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 80
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession A0A3F2YLU4 A0A3F2YLU4
Species 681288 (Staphylococcus aureus subsp. aureus ED98) 681288 (Staphylococcus aureus subsp. aureus ED98)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 7d8j-a1-m1-cA_7d8j-a1-m2-cA.pdb.gz
Full biological assembly
Download: 7d8j-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 5yyu/1/1:C/1:B 5yyu/1/1:D/1:A 7d8j/1/1:B/2:B 7dep/1/1:A/2:A 7dep/1/1:B/2:B
Other dimers with similar sequences but different poses
  • 7d8j/1/2:B/2:A 5yyu/1/1:B/1:A 7d8j/1/1:B/1:A
  • 7d8j/1/2:B/1:A 5yyu/1/1:C/1:A 5yyu/1/1:D/1:B 7d8j/1/1:B/2:A
  • [Back to Home]