7d8t/1/1:A/1:B

Sequences

>7d8t-a1-m1-cA (length=199) [Search sequence]

SLAKERQKKDNHNLIERRRRFNINDRIKELGTLIPKSNDPDMRWNKGTILKASVDYIRKL
QREQQRAKELENRQKKLEHACRHLLLRIQELGIEDFLKVDLRVAKVLSAERVEGSEKLLK
LTLSLGDEERTVVAGIAKYYTPEELVGKKIVIVANLKPRKIFGIESQGMILAASDGENLS
VIVPDRDVKEGAKLSAALE

>7d8t-a1-m1-cB (length=199) [Search sequence]

Structure information

PDB ID	7d8t (database links: RCSB PDB PDBe PDBj PDBsum)
Title	MITF bHLHLZ complex with M-box DNA
Assembly ID	1
Resolution	3.201Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	71
Sequence identity between the two chains	1.0
PubMed citation	36588115

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	O66738	O66738
Species	224324 (Aquifex aeolicus VF5)	224324 (Aquifex aeolicus VF5)
Function annotation	BioLiP:7d8tA	BioLiP:7d8tB

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	7d8t-a1-m1-cA_7d8t-a1-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	7d8t-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	4ati/1/1:A/1:B 6g1l/1/1:A/2:A
Other dimers with similar sequences but different poses	1pyb/2/1:C/1:D 1pyb/1/1:A/1:B 7eod/2/1:C/1:D 4ath/1/1:A/1:B 7eod/1/1:B/1:A 7d8r/2/1:C/1:D 7d8r/1/1:B/1:A 7d8s/2/1:D/1:C 7d8s/1/1:B/1:A