7dhb/1/1:A/2:A

Sequences
>7dhb-a1-m1-cA (length=46) [Search sequence]
FSQLLALASLLGQQQAEVQRCREDLQKKESLMMETIAKIKALALEH
>7dhb-a1-m2-cA (length=46) [Search sequence]
FSQLLALASLLGQQQAEVQRCREDLQKKESLMMETIAKIKALALEH
Structure information
PDB ID 7dhb (database links: RCSB PDB PDBe PDBj PDBsum)
Title mutant V507M coiled coil domain of Trypanosoma brucei coronin
Assembly ID 1
Resolution 3.02Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 30
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession Q57W63 Q57W63
Species 5691 (Trypanosoma brucei) 5691 (Trypanosoma brucei)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 7dhb-a1-m1-cA_7dhb-a1-m2-cA.pdb.gz
Full biological assembly
Download: 7dhb-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 7dgx/1/1:A/2:A 7dgx/1/1:B/2:B 7dh4/1/1:A/2:A 7dh4/1/1:B/2:B 7dhb/1/1:B/2:B
Other dimers with similar sequences but different poses
  • 7dh4/1/2:A/2:B 7dh4/1/1:A/1:B 7dhb/1/1:A/1:B 7dhb/1/2:A/2:B
    		•

    [Back to Home]