7dn4/1/1:C/1:F

Sequences
>7dn4-a1-m1-cC (length=118) [Search sequence]
DAMTVLTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEE
RVQRRYYEKLTEFVADMTKIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFKASRSH
>7dn4-a1-m1-cF (length=118) [Search sequence]
DAMTVLTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEE
RVQRRYYEKLTEFVADMTKIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFKASRSH
Structure information
PDB ID 7dn4 (database links: RCSB PDB PDBe PDBj PDBsum)
Title The crystal structure of Cpd8 in complex with BPTF bromodomain
Assembly ID 1
Resolution 2.841Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 25
Sequence identity between the two chains 1.0
PubMed citation 33548625
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C F
UniProt accession Q12830 Q12830
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:7dn4C BioLiP:7dn4F
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 7dn4-a1-m1-cC_7dn4-a1-m1-cF.pdb.gz
Full biological assembly
Download: 7dn4-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 7dn4/1/1:A/1:D 7dn4/1/1:B/1:E
Other dimers with similar sequences but different poses
  • 2f6n/1/1:B/1:A 2f6j/1/1:C/1:B
  • 7dn4/1/1:E/1:F 7dn4/1/1:B/1:C
  • [Back to Home]