7duf/1/1:B/1:A

Sequences
>7duf-a1-m1-cB (length=57) [Search sequence]
DIQLPCDGDGVCMRCKSNPPPEESLTCGTCVTPWHVSCLSSPPKTLASTLQWHCPDC
>7duf-a1-m1-cA (length=62) [Search sequence]
GMARDIQLPCDGDGVCMRCKSNPPPEESLTCGTCVTPWHVSCLSSPPKTLASTLQWHCPD
CS
Structure information
PDB ID 7duf (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of VIM1 PHD finger.
Assembly ID 1
Resolution 2.61Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 36
Sequence identity between the two chains 1.0
PubMed citation 34404204
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession Q8VYZ0 Q8VYZ0
Species 3702 (Arabidopsis thaliana) 3702 (Arabidopsis thaliana)
Function annotation BioLiP:7dufB BioLiP:7dufA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 7duf-a1-m1-cB_7duf-a1-m1-cA.pdb.gz
Full biological assembly
Download: 7duf-assembly1.cif.gz

[Back to Home]