7dxs/2/1:D/1:C

Sequences
>7dxs-a2-m1-cD (length=44) [Search sequence]
SSVELRVAEAYPEDVGRGIVRMDKQTRAKLGVSVGDYVEVKKVD
>7dxs-a2-m1-cC (length=49) [Search sequence]
GPMANSSVELRVAEAYPEDVGRGIVRMDKQTRAKLGVSVGDYVEVKKVD
Structure information
PDB ID 7dxs (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the ap1h peptide homodimer.
Assembly ID 2
Resolution 2.102Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 182
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D C
UniProt accession
Species 32630 (synthetic construct) 32630 (synthetic construct)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 7dxs-a2-m1-cD_7dxs-a2-m1-cC.pdb.gz
Full biological assembly
Download: 7dxs-assembly2.cif.gz
Similar dimers

[Back to Home]