7e3w/2/1:E/1:F

Sequences

>7e3w-a2-m1-cE (length=231) [Search sequence]

HMMKLSFHGQSTIYLEGNNKKVIVDPFISNNPKCDLNIETVQVDYIVLTHGHFDHFGDVV
ELAKKTGATVIGSAEMADYLSSYHGVENVHGMNIGGKANFDFGSVKFVQAFHSSSFTHEN
GIPVYLGMPMGIVFEVEGKTIYHTGDTGLFSDMSLIAKRHPVDVCFVPIGDNFTMGIDDA
SYAINEFIKPKISVPIHYDTFPLIEQDPQQFKDAVNVGDVQILKPGESVQF

>7e3w-a2-m1-cF (length=231) [Search sequence]

Structure information

PDB ID	7e3w (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Metallo beta-lactamase fold protein (cAMP bound)
Assembly ID	2
Resolution	1.55Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	86
Sequence identity between the two chains	1.0
PubMed citation	33950015

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	E	F
UniProt accession	Q2FXM0	Q2FXM0
Species	1280 (Staphylococcus aureus)	1280 (Staphylococcus aureus)
Function annotation	BioLiP:7e3wE	BioLiP:7e3wF

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	7e3w-a2-m1-cE_7e3w-a2-m1-cF.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	7e3w-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures

7e3v/1/1:A/1:B 7e3v/1/1:A/1:C 7e3v/1/1:B/1:C 7e3v/2/1:D/1:E 7e3v/2/1:D/1:F 7e3v/2/1:E/1:F 7e3w/1/1:A/1:B 7e3w/1/1:C/1:A 7e3w/1/1:C/1:B 7e3w/2/1:E/1:D 7e3w/2/1:F/1:D