7e4j/2/1:B/1:D

Sequences
>7e4j-a2-m1-cB (length=44) [Search sequence]
MSAMVQIRNVPDELLHELKARAAAQRMSLSDFLLARLAEIAEEP
>7e4j-a2-m1-cD (length=44) [Search sequence]
MSAMVQIRNVPDELLHELKARAAAQRMSLSDFLLARLAEIAEEP
Structure information
PDB ID 7e4j (database links: RCSB PDB PDBe PDBj PDBsum)
Title X-ray crystal structure of VapB12 antitoxin from mycobacterium tuberculosis in space group P41.
Assembly ID 2
Resolution 1.63Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 90
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B D
UniProt accession P9WJ53 P9WJ53
Species 1773 (Mycobacterium tuberculosis) 1773 (Mycobacterium tuberculosis)
Function annotation BioLiP:7e4jB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 7e4j-a2-m1-cB_7e4j-a2-m1-cD.pdb.gz
Full biological assembly
Download: 7e4j-assembly2.cif.gz
Similar dimers

[Back to Home]