7eaa/1/1:D/1:C

Sequences

>7eaa-a1-m1-cD (length=110) [Search sequence]

SLVAELQEKLQEEKAKFLEQLEEQEKRKNEEMQNVRTSLIAEQQTNFNTVLTREKMRKEN IINDLSDKLKSTMQQQERDKDLIESLSEDRARLLEEKKKLEEEVSKLRSS

>7eaa-a1-m1-cC (length=114) [Search sequence]

GSEFSLVAELQEKLQEEKAKFLEQLEEQEKRKNEEMQNVRTSLIAEQQTNFNTVLTREKM RKENIINDLSDKLKSTMQQQERDKDLIESLSEDRARLLEEKKKLEEEVSKLRSS

Structure information

PDB ID	7eaa (database links: RCSB PDB PDBe PDBj PDBsum)
Title	crystal structure of NDP52 SKICH domain in complex with RB1CC1 coiled-coil domain
Assembly ID	1
Resolution	2.6Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	137
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	C
UniProt accession	Q8TDY2	Q8TDY2
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 7eaa-a1-m1-cD_7eaa-a1-m1-cC.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 7eaa-assembly1.cif.gz