7eaj/1/9:F/55:F

Sequences
>7eaj-a1-m9-cF (length=112) [Search sequence]
LQQSGAELARPWASVKISCQAFYTFNSYGMQWVKQRPGQGLEWIGTIYPGNGQTSYNQRF
KGKATLTADKSPSTAYMQLISLTSEDSAGCFCAVVPTVDFDYWGQGTLVTVS
>7eaj-a1-m55-cF (length=112) [Search sequence]
LQQSGAELARPWASVKISCQAFYTFNSYGMQWVKQRPGQGLEWIGTIYPGNGQTSYNQRF
KGKATLTADKSPSTAYMQLISLTSEDSAGCFCAVVPTVDFDYWGQGTLVTVS
Structure information
PDB ID 7eaj (database links: RCSB PDB PDBe PDBj PDBsum)
Title Echovirus3 empty expanded particle in complex with 5G3 fab
Assembly ID 1
Resolution 4.1Å
Method of structure determination ELECTRON MICROSCOPY
Number of inter-chain contacts 775
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 9 55
Chain ID F F
UniProt accession
Species 10090 (Mus musculus) 10090 (Mus musculus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 7eaj-a1-m9-cF_7eaj-a1-m55-cF.pdb.gz
Full biological assembly
Download: 7eaj-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 7eaj/1/16:F/11:F 7eaj/1/23:F/2:F 7eaj/1/24:F/10:F 7eaj/1/26:F/21:F 7eaj/1/28:F/17:F 7eaj/1/29:F/15:F 7eaj/1/36:F/31:F 7eaj/1/38:F/12:F 7eaj/1/39:F/20:F 7eaj/1/42:F/3:F 7eaj/1/43:F/22:F 7eaj/1/44:F/30:F 7eaj/1/45:F/14:F 7eaj/1/46:F/41:F 7eaj/1/47:F/13:F 7eaj/1/48:F/37:F 7eaj/1/49:F/35:F 7eaj/1/50:F/4:F 7eaj/1/52:F/18:F 7eaj/1/53:F/27:F 7eaj/1/54:F/25:F 7eaj/1/56:F/51:F 7eaj/1/58:F/32:F 7eaj/1/59:F/40:F 7eaj/1/5:F/34:F 7eaj/1/60:F/19:F 7eaj/1/6:F/1:F 7eaj/1/7:F/33:F 7eaj/1/8:F/57:F

[Back to Home]