7eb9/1/1:B/1:C

Sequences

>7eb9-a1-m1-cB (length=54) [Search sequence]

KQELVTQNELLKQQVKIFEEDFQRERSDRERMNEEKEELKKQVEKLQAQVTLSN

>7eb9-a1-m1-cC (length=60) [Search sequence]

AGALLRKQELVTQNELLKQQVKIFEEDFQRERSDRERMNEEKEELKKQVEKLQAQVTLSN

Structure information

PDB ID	7eb9 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	The structure of the A20-binding inhibitor of NF-kB 1 in complex with tetra-ubiquitin
Assembly ID	1
Resolution	3.2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	76
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	C
UniProt accession	Q15025	Q15025
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 7eb9-a1-m1-cB_7eb9-a1-m1-cC.pdb.gz

Full biological assembly Download: 7eb9-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

6n5m/1/1:B/1:D 6n6r/1/1:D/1:B 6n6s/1/1:A/1:C 6n6s/1/1:B/1:D 7eal/1/1:C/1:B 7eao/1/1:C/1:B