7egl/1/2:B/3:B

Sequences
>7egl-a1-m2-cB (length=93) [Search sequence]
AKPANKLVIVTEKILLKKIAKIIDESGAKGYTVMNTGGKGANIKFEILTETREMAEEIAD
RVAVKYFNDYAGIIYICSAEVLYGHTFCGPEGC
>7egl-a1-m3-cB (length=93) [Search sequence]
AKPANKLVIVTEKILLKKIAKIIDESGAKGYTVMNTGGKGANIKFEILTETREMAEEIAD
RVAVKYFNDYAGIIYICSAEVLYGHTFCGPEGC
Structure information
PDB ID 7egl (database links: RCSB PDB PDBe PDBj PDBsum)
Title Bicarbonate transporter complex SbtA-SbtB bound to HCO3-
Assembly ID 1
Resolution 3.2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 66
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 3
Chain ID B B
UniProt accession P73954 P73954
Species 1111708 (Synechocystis sp. PCC 6803 substr. Kazusa) 1111708 (Synechocystis sp. PCC 6803 substr. Kazusa)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 7egl-a1-m2-cB_7egl-a1-m3-cB.pdb.gz
Full biological assembly
Download: 7egl-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 7egl/1/1:B/2:B 7egl/1/1:B/3:B

[Back to Home]