7eu4/5/1:I/1:J

Sequences
>7eu4-a5-m1-cI (length=84) [Search sequence]
QKIVVHLRATGGAPILKQSKFKVSGSDKFANVIDFLRRQLHSDSLFVYVNSAFSPNPDES
VIDLYNNFGFDGKLVVNYACSMAW
>7eu4-a5-m1-cJ (length=84) [Search sequence]
QKIVVHLRATGGAPILKQSKFKVSGSDKFANVIDFLRRQLHSDSLFVYVNSAFSPNPDES
VIDLYNNFGFDGKLVVNYACSMAW
Structure information
PDB ID 7eu4 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of plant ATG12 complexed with the AIM12 of ATG3
Assembly ID 5
Resolution 3.2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 232
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID I J
UniProt accession Q9LVK3 Q9LVK3
Species 3702 (Arabidopsis thaliana) 3702 (Arabidopsis thaliana)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 7eu4-a5-m1-cI_7eu4-a5-m1-cJ.pdb.gz
Full biological assembly
Download: 7eu4-assembly5.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1wz3/1/1:A/1:B 7eu4/1/1:A/1:B 7eu4/4/1:G/1:H
Other dimers with similar sequences but different poses
  • 7eu4/3/1:F/1:E 7eu4/2/1:D/1:C
  • 7eu4/7/1:N/1:M 7eu4/6/1:L/1:K
  • [Back to Home]