7eu6/1/1:B/1:A

Sequences

>7eu6-a1-m1-cB (length=111) [Search sequence]

AEIVTALPVPLAVPAPFYLTADMFGGLPVQLAGGELSKLVKPVAAPHVHEVDELYFLVSP EPGQARIEVHLDGVRHELVSPAVMRIPAGSEHCFLTLEATVGSYCFGILVG

>7eu6-a1-m1-cA (length=119) [Search sequence]

DAEIVTALPVPLAVAGHHQPAPFYLTADMFGGLPVQLAGGELSKLVGKPVAAPHVHEVDE LYFLVSPEPGQARIEVHLDGVRHELVSPAVMRIPAGSEHCFLTLEATVGSYCFGILVGD

Structure information

PDB ID	7eu6 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structural and mechanistic studies of a novel non-heme iron epimerase/lyase and its utilization in chemoselective synthesis.
Assembly ID	1
Resolution	2.05011Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	105
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	L7PIL3	L7PIL3
Species	1888 (Streptomyces albus)	1888 (Streptomyces albus)
Function annotation	BioLiP:7eu6B	BioLiP:7eu6A

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 7eu6-a1-m1-cB_7eu6-a1-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 7eu6-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

7eqk/1/1:B/1:A 7eue/1/1:B/1:A 7eup/1/1:B/1:A 7euz/1/1:B/1:A 7f6x/1/1:B/1:A