7evp/1/1:C/1:D

Sequences
>7evp-a1-m1-cC (length=43) [Search sequence]
LSYYRGGHKDLESMFELALEYIEKLEEEDEQQVTDYENAMEEE
>7evp-a1-m1-cD (length=43) [Search sequence]
LSYYRGGHKDLESMFELALEYIEKLEEEDEQQVTDYENAMEEE
Structure information
PDB ID 7evp (database links: RCSB PDB PDBe PDBj PDBsum)
Title Cryo-EM structure of the Gp168-beta-clamp complex
Assembly ID 1
Resolution 3.2Å
Method of structure determination ELECTRON MICROSCOPY
Number of inter-chain contacts 31
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C D
UniProt accession Q4Z971 Q4Z971
Species 55510 (Twortvirus twort) 55510 (Twortvirus twort)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 7evp-a1-m1-cC_7evp-a1-m1-cD.pdb.gz
Full biological assembly
Download: 7evp-assembly1.cif.gz

[Back to Home]