7ewj/2/1:D/1:E

Sequences
>7ewj-a2-m1-cD (length=110) [Search sequence]
NIKQFDILYIDLNPTRGREKHNVRPCLVINNQMSIDGTNFVWVLPITTRGLRYPTDIQLK
TKKGLVSGVIDTVQIRALDLKARQYNYKDELQDNLKNDILKAIKTYLKPT
>7ewj-a2-m1-cE (length=113) [Search sequence]
SHMNIKQFDILYIDLNPTRGREKHNVRPCLVINNQMSIDGTNFVWVLPITTRGLRYPTDI
QLKTKKGLVSGVIDTVQIRALDLKARQYNYKDELQDNLKNDILKAIKTYLKPT
Structure information
PDB ID 7ewj (database links: RCSB PDB PDBe PDBj PDBsum)
Title Toxin-antitoxin complex from Staphylococcus aureus
Assembly ID 2
Resolution 2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 68
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D E
UniProt accession L7PFJ6 L7PFJ6
Species 1280 (Staphylococcus aureus) 1280 (Staphylococcus aureus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 7ewj-a2-m1-cD_7ewj-a2-m1-cE.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 7ewj-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 7ewi/1/1:C/1:A 7ewi/2/1:B/1:D 7ewj/1/1:A/1:B 7ewj/3/1:G/1:H

[Back to Home]