7eyd/1/1:V8/1:r8

Sequences
>7eyd-a1-m1-cV8 (length=159) [Search sequence]
IVTKSIVNADAEARYLSPGELDRIKSFVAGGQQRLRIAQALTDNRERLVKQAGDQLFQKR
PDVVSPGGNAYGQEMTATCLRDLDYYLRLVTYGIVAGDVTPIEEIGVIGVREMYKSLGTP
IEAVGEGVRALKNAASTLLSAEDAAEAGSYFDYVVGALQ
>7eyd-a1-m1-cr8 (length=159) [Search sequence]
IVTKSIVNADAEARYLSPGELDRIKSFVAGGQQRLRIAQALTDNRERLVKQAGDQLFQKR
PDVVSPGGNAYGQEMTATCLRDLDYYLRLVTYGIVAGDVTPIEEIGVIGVREMYKSLGTP
IEAVGEGVRALKNAASTLLSAEDAAEAGSYFDYVVGALQ
Structure information
PDB ID 7eyd (database links: RCSB PDB PDBe PDBj PDBsum)
Title Cryo-EM structure of cyanobacterial phycobilisome from Anabaena sp. PCC 7120
Assembly ID 1
Resolution 3.9Å
Method of structure determination ELECTRON MICROSCOPY
Number of inter-chain contacts 16
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID V8 r8
UniProt accession P80555 P80555
Species 103690 (Nostoc sp. PCC 7120 = FACHB-418) 103690 (Nostoc sp. PCC 7120 = FACHB-418)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 7eyd-a1-m1-cV8_7eyd-a1-m1-cr8.pdb.gz
Full biological assembly
Download: 7eyd-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 7eyd/1/1:A8/1:K9 7eyd/1/1:A9/1:q9 7eyd/1/1:C8/1:I9 7eyd/1/1:c8/1:l8 7eyd/1/1:C9/1:o9 7eyd/1/1:e8/1:j8 7eyd/1/1:g8/1:n8 7eyd/1/1:H8/1:Z9 7eyd/1/1:J8/1:X9 7eyd/1/1:O8/1:w9 7eyd/1/1:Q8/1:u9 7eyd/1/1:X8/1:p8 7eyd/1/1:Z8/1:t8
Other dimers with similar sequences but different poses
  • 7eyd/1/1:O8/1:u9 7eyd/1/1:A8/1:I9 7eyd/1/1:A9/1:o9 7eyd/1/1:C8/1:G9 7eyd/1/1:c8/1:j8 7eyd/1/1:C9/1:s9 7eyd/1/1:d9/1:i9 7eyd/1/1:E8/1:K9 7eyd/1/1:e8/1:n8 7eyd/1/1:E9/1:q9 7eyd/1/1:g8/1:l8 7eyd/1/1:H8/1:X9 7eyd/1/1:J8/1:b9 7eyd/1/1:L8/1:Z9 7eyd/1/1:N9/1:R9 7eyd/1/1:Q8/1:y9 7eyd/1/1:S8/1:w9 7eyd/1/1:V8/1:p8 7eyd/1/1:X8/1:t8 7eyd/1/1:Z8/1:r8
  • 7eyd/1/1:b9/1:y9 7eyd/1/1:E8/1:E9 7eyd/1/1:G9/1:f9 7eyd/1/1:G9/1:s9 7eyd/1/1:L8/1:S8 7eyd/1/1:P9/1:b9
  • 7eyd/1/1:X9/1:g8 7eyd/1/1:I9/1:Z8
  • 7eyd/1/1:C8/1:t8 7eyd/1/1:J8/1:n8
  • 7eyd/1/1:E8/1:f9 7eyd/1/1:L8/1:P9
  • [Back to Home]