7f5y/1/2:A/2:B

Sequences
>7f5y-a1-m2-cA (length=109) [Search sequence]
KTMAGDTTITIVGNLTADPELRFTPSGAAVANFTVASTPRKDGEALFLRCNIWREAAENV
AESLTRGARVIVSGRLKQRSFEGEKRTVIEVEVDEIGPSLRYATAKVNK
>7f5y-a1-m2-cB (length=120) [Search sequence]
MAGDTTITIVGNLTADPELRFTPSGAAVANFTVASTPRIYDRQTGEWKDGEALFLRCNIW
REAAENVAESLTRGARVIVSGRLKQRSFETREGEKRTVIEVEVDEIGPSLRYATAKVNKA
Structure information
PDB ID 7f5y (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the single-stranded dna-binding protein from Mycobacterium tuberculosis- Form III
Assembly ID 1
Resolution 1.92Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 114
Sequence identity between the two chains 0.982
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID A B
UniProt accession P9WGD5 P9WGD5
Species 83332 (Mycobacterium tuberculosis H37Rv) 83332 (Mycobacterium tuberculosis H37Rv)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 7f5y-a1-m2-cA_7f5y-a1-m2-cB.pdb.gz
Full biological assembly
Download: 7f5y-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1ue6/2/1:D/3:D 7f5y/1/1:A/1:B
Other dimers with similar sequences but different poses
  • 1ue1/1/1:B/2:B 1x3f/1/1:B/2:B 1x3g/1/1:B/2:B 7f5y/1/1:A/2:B
  • [Back to Home]