7f5z/1/2:A/2:B

Sequences
>7f5z-a1-m2-cA (length=117) [Search sequence]
MAGDTTITIVGNLTADPELRFTPSGAAVANFTVASTPRIRQTGEWKDGEALFLRCNIWRE
AAENVAESLTRGARVIVSGRLKQRSFETREGEKRTVIEVEVDEIGPSLRYATAKVNK
>7f5z-a1-m2-cB (length=118) [Search sequence]
MAGDTTITIVGNLTADPELRFTPSGAAVANFTVASTPRIYQTGEWKDGEALFLRCNIWRE
AAENVAESLTRGARVIVSGRLKQRSFETREGEKRTVIEVEVDEIGPSLRYATAKVNKA
Structure information
PDB ID 7f5z (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the single-stranded dna-binding protein from Mycobacterium tuberculosis- Form III
Assembly ID 1
Resolution 3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 110
Sequence identity between the two chains 0.991
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID A B
UniProt accession P9WGD5 P9WGD5
Species 83332 (Mycobacterium tuberculosis H37Rv) 83332 (Mycobacterium tuberculosis H37Rv)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 7f5z-a1-m2-cA_7f5z-a1-m2-cB.pdb.gz
Full biological assembly
Download: 7f5z-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3afp/1/1:A/1:B 3afp/1/2:A/2:B 3afq/1/1:C/1:B 7f5z/1/1:A/1:B
Other dimers with similar sequences but different poses
  • 7f5z/1/1:B/2:B 3afp/1/1:A/2:A 7f5z/1/1:A/2:A
  • [Back to Home]