7jta/1/1:A/4:A

Sequences

>7jta-a1-m1-cA (length=56) [Search sequence]

MGMVVEETRDLAETADCVVIEAILVDDGLRYRQLSVGIKDENGDIIRIVPISTVLI

>7jta-a1-m4-cA (length=56) [Search sequence]

MGMVVEETRDLAETADCVVIEAILVDDGLRYRQLSVGIKDENGDIIRIVPISTVLI

Structure information

PDB ID	7jta (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of a putative nuclease with anti-Cas9 activity from an uncultured Clostridia bacterium
Assembly ID	1
Resolution	2.801Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	41
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	4
Chain ID	A	A
UniProt accession	A0A5B9TEE9	A0A5B9TEE9
Species	2044939 (Clostridia bacterium)	2044939 (Clostridia bacterium)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 7jta-a1-m1-cA_7jta-a1-m4-cA.pdb.gz

Full biological assembly Download: 7jta-assembly1.cif.gz