7jta/1/2:B/4:A

Sequences
>7jta-a1-m2-cB (length=56) [Search sequence]
MGMVVEETRDLAETADCVVIEAILVDDGLRYRQLSVGIKDENGDIIRIVPISTVLI
>7jta-a1-m4-cA (length=56) [Search sequence]
MGMVVEETRDLAETADCVVIEAILVDDGLRYRQLSVGIKDENGDIIRIVPISTVLI
Structure information
PDB ID 7jta (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of a putative nuclease with anti-Cas9 activity from an uncultured Clostridia bacterium
Assembly ID 1
Resolution 2.801Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 26
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 4
Chain ID B A
UniProt accession A0A5B9TEE9 A0A5B9TEE9
Species 2044939 (Clostridia bacterium) 2044939 (Clostridia bacterium)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 7jta-a1-m2-cB_7jta-a1-m4-cA.pdb.gz
Full biological assembly
Download: 7jta-assembly1.cif.gz
Similar dimers

[Back to Home]