7jw1/1/5:e/9:e

Sequences
>7jw1-a1-m5-ce (length=235) [Search sequence]
PEYLQPALAQLEKARAAHLENARLMDETVTAIERAEQEKNALAQADGNDADDWRTAFRAA
GGVLSDELKQRHIERVARRELVQEYDNLAVVLNFERERLKGACDSTATAYRKAHHHLLSL
YAEHELEHALNETCEALVRAMHLSILVQENPLANTTGHQGYVAPEKAVMQQVKSSLEQKI
KQMQISLTGEPVLRLTGLSAATLPHMDYEVAGTPAQRKVWQDKIDQQGAELKARG
>7jw1-a1-m9-ce (length=235) [Search sequence]
PEYLQPALAQLEKARAAHLENARLMDETVTAIERAEQEKNALAQADGNDADDWRTAFRAA
GGVLSDELKQRHIERVARRELVQEYDNLAVVLNFERERLKGACDSTATAYRKAHHHLLSL
YAEHELEHALNETCEALVRAMHLSILVQENPLANTTGHQGYVAPEKAVMQQVKSSLEQKI
KQMQISLTGEPVLRLTGLSAATLPHMDYEVAGTPAQRKVWQDKIDQQGAELKARG
Structure information
PDB ID 7jw1 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Satellite phage P4 procapsid including size determination (Sid) protein
Assembly ID 1
Resolution 4.19Å
Method of structure determination ELECTRON MICROSCOPY
Number of inter-chain contacts 28
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 5 9
Chain ID e e
UniProt accession P05461 P05461
Species 10680 (Enterobacteria phage P4) 10680 (Enterobacteria phage P4)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 7jw1-a1-m5-ce_7jw1-a1-m9-ce.pdb.gz
Full biological assembly
Download: 7jw1-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 7jw1/1/10:e/13:e 7jw1/1/10:e/14:E 7jw1/1/10:E/5:e 7jw1/1/10:E/9:e 7jw1/1/11:E/12:E 7jw1/1/11:E/13:E 7jw1/1/11:e/8:e 7jw1/1/12:E/13:E 7jw1/1/12:e/15:e 7jw1/1/12:e/29:E 7jw1/1/13:e/14:E 7jw1/1/14:e/17:e 7jw1/1/14:e/18:E 7jw1/1/15:E/16:E 7jw1/1/15:E/17:E 7jw1/1/15:e/29:E 7jw1/1/16:E/17:E 7jw1/1/16:e/19:e 7jw1/1/16:e/27:E 7jw1/1/17:e/18:E 7jw1/1/18:e/21:e 7jw1/1/18:e/6:e 7jw1/1/19:E/20:E 7jw1/1/19:E/21:E 7jw1/1/19:e/27:E 7jw1/1/1:e/11:e 7jw1/1/1:E/24:e 7jw1/1/1:E/30:e 7jw1/1/1:e/8:e 7jw1/1/20:E/21:E 7jw1/1/20:e/25:E 7jw1/1/21:e/6:e 7jw1/1/22:e/23:E 7jw1/1/22:e/24:E 7jw1/1/22:E/3:e 7jw1/1/22:E/7:e 7jw1/1/23:E/24:E 7jw1/1/23:e/25:e 7jw1/1/23:e/26:E 7jw1/1/24:e/30:e 7jw1/1/25:e/26:E 7jw1/1/26:e/27:e 7jw1/1/26:e/28:E 7jw1/1/27:e/28:E 7jw1/1/28:e/29:e 7jw1/1/28:e/30:E 7jw1/1/29:e/30:E 7jw1/1/2:e/20:e 7jw1/1/2:e/25:E 7jw1/1/2:E/3:E 7jw1/1/2:E/4:E 7jw1/1/3:E/4:E 7jw1/1/3:e/7:e 7jw1/1/4:e/5:E 7jw1/1/4:e/6:E 7jw1/1/5:E/6:E 7jw1/1/7:E/8:E 7jw1/1/7:E/9:E 7jw1/1/8:E/9:E
Other dimers with similar sequences but different poses
  • 7jw1/1/9:E/9:e 7jw1/1/10:E/10:e 7jw1/1/11:E/11:e 7jw1/1/12:E/12:e 7jw1/1/13:E/13:e 7jw1/1/14:E/14:e 7jw1/1/15:E/15:e 7jw1/1/16:E/16:e 7jw1/1/17:E/17:e 7jw1/1/18:E/18:e 7jw1/1/19:E/19:e 7jw1/1/1:E/1:e 7jw1/1/20:E/20:e 7jw1/1/21:E/21:e 7jw1/1/22:E/22:e 7jw1/1/23:E/23:e 7jw1/1/24:E/24:e 7jw1/1/25:E/25:e 7jw1/1/26:E/26:e 7jw1/1/27:E/27:e 7jw1/1/28:E/28:e 7jw1/1/29:E/29:e 7jw1/1/2:E/2:e 7jw1/1/30:E/30:e 7jw1/1/3:E/3:e 7jw1/1/4:E/4:e 7jw1/1/5:E/5:e 7jw1/1/6:E/6:e 7jw1/1/7:E/7:e 7jw1/1/8:E/8:e
  • [Back to Home]