7k7a/1/1:A/1:C

Sequences

>7k7a-a1-m1-cA (length=30) [Search sequence]

GTTVLLPLVIFFGLALLSLLFIGLAYRYQR

>7k7a-a1-m1-cC (length=30) [Search sequence]

GTTVLLPLVIFFGLALLSLLFIGLAYRYQR

Structure information

PDB ID	7k7a (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Transmembrane structure of TNFR1
Assembly ID	1
Resolution	Not applicable
Method of structure determination	SOLUTION NMR
Number of inter-chain contacts	14
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	C
UniProt accession	P19438	P19438
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 7k7a-a1-m1-cA_7k7a-a1-m1-cC.pdb.gz

Full biological assembly Download: 7k7a-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

7k7a/1/1:A/1:B 7k7a/1/1:B/1:C