7kcn/1/2:A/2:B

Sequences
>7kcn-a1-m2-cA (length=114) [Search sequence]
ESPLTTHVLNVAMGVPASNVTLRLYRQDPSSKTWQLLNTGITNEDGRYPGLITKELFTAG
VYKLHFETAQYWASLGDTSFYPYVEIVFTINDPGQKYHVPLLLSRFSYSTYRGS
>7kcn-a1-m2-cB (length=117) [Search sequence]
ASSESPLTTHVLNVAMGVPASNVTLRLYRQDPSSKTWQLLNTGITNEDGRYPGLITKELF
TAGVYKLHFETAQYWASLGDTSFYPYVEIVFTINDPGQKYHVPLLLSRFSYSTYRGS
Structure information
PDB ID 7kcn (database links: RCSB PDB PDBe PDBj PDBsum)
Title Reconstructed ancestor of HIUases and Transthyretins
Assembly ID 1
Resolution 1.46Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 29
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID A B
UniProt accession A0A3B3I7P0 A0A3B3I7P0
Species 32630 (synthetic construct) 32630 (synthetic construct)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 7kcn-a1-m2-cA_7kcn-a1-m2-cB.pdb.gz
Full biological assembly
Download: 7kcn-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 7kcn/1/1:B/2:B 7kcn/1/1:A/2:A
  • 7kcn/1/1:A/2:B 7kcn/1/2:A/1:B
  • [Back to Home]