7kjj/1/1:B/2:B

Sequences
>7kjj-a1-m1-cB (length=114) [Search sequence]
CPLMVKVLDAVRGVPASNVAVKVFKQDESGSWQQLSTGVTNETGEIHNLITEEAFTEGVY
KVHFDTKTYWKSLGLTPFYEYADVVFTANDAGHRHYTIALLLSPYSYSTTAVVS
>7kjj-a1-m2-cB (length=114) [Search sequence]
CPLMVKVLDAVRGVPASNVAVKVFKQDESGSWQQLSTGVTNETGEIHNLITEEAFTEGVY
KVHFDTKTYWKSLGLTPFYEYADVVFTANDAGHRHYTIALLLSPYSYSTTAVVS
Structure information
PDB ID 7kjj (database links: RCSB PDB PDBe PDBj PDBsum)
Title Reconstructed ancestor of HIUases and Transthyretins
Assembly ID 1
Resolution 1.55Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 29
Sequence identity between the two chains 1.0
PubMed citation 33956179
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID B B
UniProt accession
Species 32644 (unidentified) 32644 (unidentified)
Function annotation BioLiP:7kjjB BioLiP:7kjjB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 7kjj-a1-m1-cB_7kjj-a1-m2-cB.pdb.gz
Full biological assembly
Download: 7kjj-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 7kjj/1/2:B/2:A 7kjj/1/1:B/1:A
  • 7kjj/1/2:B/1:A 7kjj/1/1:B/2:A
  • [Back to Home]