7kld/1/2:A/2:B

Sequences

>7kld-a1-m2-cA (length=100) [Search sequence]

MITVDITVNDEGKVTDVIMDGHAHDIVCAGASAVLFGSVNAIIGLTSERPDINYDDNGGH FHIRSVDTNNDEAQLILQTMLVSLQTIEEEYNENIRLNYK

>7kld-a1-m2-cB (length=106) [Search sequence]

MITVDITVNDEGKVTDVIMDGHADHGEYGHDIVCAGASAVLFGSVNAIIGLTSERPDINY DDNGGHFHIRSVDTNNDEAQLILQTMLVSLQTIEEEYNENIRLNYK

Structure information

PDB ID	7kld (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of an Essential Ribosomal Processing Protease Prp from S. aureus in complex with a covalently linked product Peptide
Assembly ID	1
Resolution	2.25Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	31
Sequence identity between the two chains	1.0
PubMed citation	35731716

Chain information

	Chain 1	Chain 2
Model ID	2	2
Chain ID	A	B
UniProt accession	Q2FXS9	Q2FXS9
Species	1280 (Staphylococcus aureus)	1280 (Staphylococcus aureus)
Function annotation	BioLiP:7kldA	BioLiP:7kldB

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 7kld-a1-m2-cA_7kld-a1-m2-cB.pdb.gz

Full biological assembly Download: 7kld-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	7kld/1/1:A/1:B 7kld/1/3:D/4:D
Other dimers with similar sequences but different poses	4peo/1/1:A/1:B 7jvs/1/1:B/1:D 7kld/1/1:A/2:B 7kld/1/2:A/1:B