7kpo/1/1:A/2:A

Sequences
>7kpo-a1-m1-cA (length=104) [Search sequence]
GSSKQDLRAVLVEATSALNYWERVSGQSKFTFAEQSGLWRVYLDRSTLQTRTLDKYLRIE
TLPKTPRWRTVLNSLDYILEHCKEAGPERTHIEQRDKLQKLLTS
>7kpo-a1-m2-cA (length=104) [Search sequence]
GSSKQDLRAVLVEATSALNYWERVSGQSKFTFAEQSGLWRVYLDRSTLQTRTLDKYLRIE
TLPKTPRWRTVLNSLDYILEHCKEAGPERTHIEQRDKLQKLLTS
Structure information
PDB ID 7kpo (database links: RCSB PDB PDBe PDBj PDBsum)
Title High Resolution Crystal Structure of the DNA-binding Domain from the Sensor Histidine Kinase ChiS from Vibrio cholerae
Assembly ID 1
Resolution 1.28Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 25
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession Q9KUA1 Q9KUA1
Species 686 (Vibrio cholerae O1 biovar El Tor) 686 (Vibrio cholerae O1 biovar El Tor)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 7kpo-a1-m1-cA_7kpo-a1-m2-cA.pdb.gz
Full biological assembly
Download: 7kpo-assembly1.cif.gz

[Back to Home]