7kpo/2/1:A/3:A

Sequences

>7kpo-a2-m1-cA (length=104) [Search sequence]

GSSKQDLRAVLVEATSALNYWERVSGQSKFTFAEQSGLWRVYLDRSTLQTRTLDKYLRIE TLPKTPRWRTVLNSLDYILEHCKEAGPERTHIEQRDKLQKLLTS

>7kpo-a2-m3-cA (length=104) [Search sequence]

GSSKQDLRAVLVEATSALNYWERVSGQSKFTFAEQSGLWRVYLDRSTLQTRTLDKYLRIE TLPKTPRWRTVLNSLDYILEHCKEAGPERTHIEQRDKLQKLLTS

Structure information

PDB ID	7kpo (database links: RCSB PDB PDBe PDBj PDBsum)
Title	High Resolution Crystal Structure of the DNA-binding Domain from the Sensor Histidine Kinase ChiS from Vibrio cholerae
Assembly ID	2
Resolution	1.28Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	24
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	3
Chain ID	A	A
UniProt accession	Q9KUA1	Q9KUA1
Species	686 (Vibrio cholerae O1 biovar El Tor)	686 (Vibrio cholerae O1 biovar El Tor)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 7kpo-a2-m1-cA_7kpo-a2-m3-cA.pdb.gz

Full biological assembly Download: 7kpo-assembly2.cif.gz