7lf2/1/1:G/1:P

Sequences

>7lf2-a1-m1-cG (length=211) [Search sequence]

EVQLVQSGAEVKKVKVSCKASGYTFTDYYMNWVRQAPGQGLEWIGVISPYNGGTTYNQKF
KGKATLTVDKSTSTAYMELSSTAVYYCVYDLYYFDYWGQGTLVTVSSASTKGPSVFPLAP
CSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPS
SSLGTKTYTCNVDHKPSNTKVDKRVESKYGP

>7lf2-a1-m1-cP (length=211) [Search sequence]

Structure information

PDB ID	7lf2 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Trimeric human Arginase 1 in complex with mAb4
Assembly ID	1
Resolution	3.72Å
Method of structure determination	ELECTRON MICROSCOPY
Number of inter-chain contacts	14
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	G	P
UniProt accession
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	7lf2-a1-m1-cG_7lf2-a1-m1-cP.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	7lf2-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

7lf2/1/1:D/1:K 7lf2/1/1:F/1:O