7lua/1/1:i/1:h

Sequences

>7lua-a1-m1-ci (length=219) [Search sequence]

QDLLLQSGAEVREPGASVTVSCQASNYTFPDYYIHWVRLVPGQGLEWLGEMKPKVGVTNV
SKKIRDRLFMTADTSTDTAYMVLSALTPGDTAIYYCTRLEPDFLSGWAHWGKGVLVTVSP
ASTKGPSVFPLAPSSRSTSESTAALGCLVKDYFPEPVTVSWNSGSLTSGVHTFPAVLQSS
GLYSLSSVVTVPSSSLGTQTYVCNVNHKPSNTKVDKRVE

>7lua-a1-m1-ch (length=219) [Search sequence]

Structure information

PDB ID	7lua (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Cryo-EM structure of DH898.1 Fab-dimer bound near the CD4 binding site of HIV-1 Env CH848 SOSIP trimer
Assembly ID	1
Resolution	4.7Å
Method of structure determination	ELECTRON MICROSCOPY
Number of inter-chain contacts	32
Sequence identity between the two chains	1.0
PubMed citation	34019795

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	i	h
UniProt accession
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:7luah

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	7lua-a1-m1-ci_7lua-a1-m1-ch.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	7lua-assembly1.cif.gz

Similar dimers