7lv9/1/1:A/1:E

Sequences
>7lv9-a1-m1-cA (length=102) [Search sequence]
CRQKGAGSAGTGSETNSQEVRSQMRSTCLIIPKERFRTMAKEISKKEGHDVHIAEAALDM
LQVIVESCTVRLLEKALVITYSGKRTRVTSKDIETAFMLEHG
>7lv9-a1-m1-cE (length=102) [Search sequence]
CRQKGAGSAGTGSETNSQEVRSQMRSTCLIIPKERFRTMAKEISKKEGHDVHIAEAALDM
LQVIVESCTVRLLEKALVITYSGKRTRVTSKDIETAFMLEHG
Structure information
PDB ID 7lv9 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Marseillevirus heterotrimeric (hexameric) nucleosome
Assembly ID 1
Resolution 4.5Å
Method of structure determination ELECTRON MICROSCOPY
Number of inter-chain contacts 32
Sequence identity between the two chains 1.0
PubMed citation 33927388
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A E
UniProt accession D2XB48 D2XB48
Species 694581 (Marseillevirus marseillevirus) 694581 (Marseillevirus marseillevirus)
Function annotation BioLiP:7lv9A BioLiP:7lv9E
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 7lv9-a1-m1-cA_7lv9-a1-m1-cE.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 7lv9-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 7lv8/1/1:A/1:E 7n8n/1/1:A/1:C

[Back to Home]