7lwr/4/1:D/1:G

Sequences
>7lwr-a4-m1-cD (length=54) [Search sequence]
MKVNKKRLAEIFNVDPRTIERWQSQGLPCASKGSKGIESVFDTAMAIQWYAQRE
>7lwr-a4-m1-cG (length=54) [Search sequence]
MKVNKKRLAEIFNVDPRTIERWQSQGLPCASKGSKGIESVFDTAMAIQWYAQRE
Structure information
PDB ID 7lwr (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structural and Biochemical Insight into Assembly of Molecular Motors Involved in Viral DNA Packaging
Assembly ID 4
Resolution 2.35Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 37
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D G
UniProt accession P68654 P68654
Species 10711 (Enterobacteria phage P21) 10711 (Enterobacteria phage P21)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 7lwr-a4-m1-cD_7lwr-a4-m1-cG.pdb.gz
Full biological assembly
Download: 7lwr-assembly4.cif.gz
Similar dimers
Other dimers with similar sequences and structures 7lwr/1/1:A/2:H 7lwr/2/1:B/1:F 7lwr/3/1:C/1:E

[Back to Home]