7lwr/4/1:D/1:G

Sequences

>7lwr-a4-m1-cD (length=54) [Search sequence]

MKVNKKRLAEIFNVDPRTIERWQSQGLPCASKGSKGIESVFDTAMAIQWYAQRE

>7lwr-a4-m1-cG (length=54) [Search sequence]

MKVNKKRLAEIFNVDPRTIERWQSQGLPCASKGSKGIESVFDTAMAIQWYAQRE

Structure information

PDB ID	7lwr (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structural and Biochemical Insight into Assembly of Molecular Motors Involved in Viral DNA Packaging
Assembly ID	4
Resolution	2.35Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	37
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	G
UniProt accession	P68654	P68654
Species	10711 (Enterobacteria phage P21)	10711 (Enterobacteria phage P21)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 7lwr-a4-m1-cD_7lwr-a4-m1-cG.pdb.gz

Full biological assembly Download: 7lwr-assembly4.cif.gz

Similar dimers

Other dimers with similar sequences and structures

7lwr/1/1:A/2:H 7lwr/2/1:B/1:F 7lwr/3/1:C/1:E