7lxs/4/1:F/2:G

Sequences

>7lxs-a4-m1-cF (length=55) [Search sequence]

MNVNKKKLAEIFGCDVRTVTAWQSQGLPLVSGGGKGNEAVFDTAAAISWYAERDA

>7lxs-a4-m2-cG (length=55) [Search sequence]

MNVNKKKLAEIFGCDVRTVTAWQSQGLPLVSGGGKGNEAVFDTAAAISWYAERDA

Structure information

PDB ID	7lxs (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structural and Biochemical Insight into Assembly of Molecular Motors Involved in Viral DNA Packaging
Assembly ID	4
Resolution	2.21Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	46
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	2
Chain ID	F	G
UniProt accession	Q8ZMZ2	Q8ZMZ2
Species	38018 (Bacteriophage sp.)	38018 (Bacteriophage sp.)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 7lxs-a4-m1-cF_7lxs-a4-m2-cG.pdb.gz

Full biological assembly Download: 7lxs-assembly4.cif.gz

Similar dimers

Other dimers with similar sequences and structures

7lxs/1/1:A/1:C 7lxs/2/1:B/2:D 7lxs/3/1:E/1:H