7lxs/4/1:F/2:G

Sequences
>7lxs-a4-m1-cF (length=55) [Search sequence]
MNVNKKKLAEIFGCDVRTVTAWQSQGLPLVSGGGKGNEAVFDTAAAISWYAERDA
>7lxs-a4-m2-cG (length=55) [Search sequence]
MNVNKKKLAEIFGCDVRTVTAWQSQGLPLVSGGGKGNEAVFDTAAAISWYAERDA
Structure information
PDB ID 7lxs (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structural and Biochemical Insight into Assembly of Molecular Motors Involved in Viral DNA Packaging
Assembly ID 4
Resolution 2.21Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 46
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID F G
UniProt accession Q8ZMZ2 Q8ZMZ2
Species 38018 (Bacteriophage sp.) 38018 (Bacteriophage sp.)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 7lxs-a4-m1-cF_7lxs-a4-m2-cG.pdb.gz
Full biological assembly
Download: 7lxs-assembly4.cif.gz
Similar dimers
Other dimers with similar sequences and structures 7lxs/1/1:A/1:C 7lxs/2/1:B/2:D 7lxs/3/1:E/1:H

[Back to Home]