7m59/1/2:B/3:B

Sequences

>7m59-a1-m2-cB (length=64) [Search sequence]

PVIQCDIRQGRTAEQKQAMAEAITRAVHETIGAPVEYIYVLIRETPGAHHVKAGRTLPEY TGDG

>7m59-a1-m3-cB (length=64) [Search sequence]

PVIQCDIRQGRTAEQKQAMAEAITRAVHETIGAPVEYIYVLIRETPGAHHVKAGRTLPEY TGDG

Structure information

PDB ID	7m59 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of N2, a member of 4-oxalocrotonate tautomerase (4-OT) family
Assembly ID	1
Resolution	1.65Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	45
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	2	3
Chain ID	B	B
UniProt accession	A0A0S8FF56	A0A0S8FF56
Species	1703405 (Gammaproteobacteria bacterium SG8_31)	1703405 (Gammaproteobacteria bacterium SG8_31)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 7m59-a1-m2-cB_7m59-a1-m3-cB.pdb.gz

Full biological assembly Download: 7m59-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	7m59/1/1:A/2:A 7m59/1/1:A/3:A 7m59/1/1:B/2:B 7m59/1/1:B/3:B 7m59/1/2:A/3:A
Other dimers with similar sequences but different poses	7m59/1/3:A/3:B 7m59/1/1:A/1:B 7m59/1/2:A/2:B