7m5c/4/1:H/1:G

Sequences
>7m5c-a4-m1-cH (length=22) [Search sequence]
SSTMGQVGRQLAIIGDDINRRY
>7m5c-a4-m1-cG (length=139) [Search sequence]
SEEQVAQDTEEVFRSYVFYRHQQEPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQP
TAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFM
LHHSIARWIAQRGGWVAAL
Structure information
PDB ID 7m5c (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of human BAK in complex with WT BAK BH3 peptide
Assembly ID 4
Resolution 3.06Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 70
Sequence identity between the two chains 1.0
PubMed citation 35017502
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID H G
UniProt accession Q16611 Q16611
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:7m5cG
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 7m5c-a4-m1-cH_7m5c-a4-m1-cG.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 7m5c-assembly4.cif.gz

[Back to Home]