7mnk/1/1:B/1:D

Sequences
>7mnk-a1-m1-cB (length=30) [Search sequence]
SYEDQNSLLKMICQQVEAIKKEMQELKLNS
>7mnk-a1-m1-cD (length=30) [Search sequence]
SYEDQNSLLKMICQQVEAIKKEMQELKLNS
Structure information
PDB ID 7mnk (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the tetramerization element of NUP358/RanBP2 (residues 805-832)
Assembly ID 1
Resolution 1.1Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 12
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B D
UniProt accession P49792 P49792
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 7mnk-a1-m1-cB_7mnk-a1-m1-cD.pdb.gz
Full biological assembly
Download: 7mnk-assembly1.cif.gz

[Back to Home]