7mp3/1/1:B/1:A

Sequences
>7mp3-a1-m1-cB (length=97) [Search sequence]
QLWFHGRISREESQRLIGQQGLVDGLFLVRESPQGFVLSLCHLQKVKHYLILPSEEEGRL
YFSMDDGQTRFTDLLQLVEFHQLNRGILPCLLRHCCT
>7mp3-a1-m1-cA (length=102) [Search sequence]
IHRTQLWFHGRISREESQRLIGQQGLVDGLFLVRESQRQGFVLSLCHLQKVKHYLILPSE
EEGRLYFSMDDGQTRFTDLLQLVEFHQLNRGILPCLLRHCCT
Structure information
PDB ID 7mp3 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Grb7-SH2 domain in complex with bicyclic peptide B8
Assembly ID 1
Resolution 2.55Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 22
Sequence identity between the two chains 0.99
PubMed citation 35625882
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession Q14451 Q14451
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:7mp3A
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 7mp3-a1-m1-cB_7mp3-a1-m1-cA.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 7mp3-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2qms/3/1:A/1:B 2qms/4/1:C/1:D 5tyi/1/1:A/1:B 5tyi/2/1:D/1:C 5u06/1/1:B/1:A 5u06/2/1:D/1:C 5u1q/1/1:A/1:B 5u1q/2/1:D/1:C
Other dimers with similar sequences but different poses
  • 2qms/2/1:B/2:D 2qms/1/1:A/2:C
  • [Back to Home]