7mrh/1/1:A/1:B

Sequences
>7mrh-a1-m1-cA (length=109) [Search sequence]
STNQLQYLQKVVLKDLWKHSFSWPFQRPVDAVKLQLPDYYTIIKNPMDLNTIKKRLENKY
YAKASECIEDFNTMFSNCYLYNKPGDDIVLMAQALEKLFMQKLSQMPQE
>7mrh-a1-m1-cB (length=109) [Search sequence]
STNQLQYLQKVVLKDLWKHSFSWPFQRPVDAVKLQLPDYYTIIKNPMDLNTIKKRLENKY
YAKASECIEDFNTMFSNCYLYNKPGDDIVLMAQALEKLFMQKLSQMPQE
Structure information
PDB ID 7mrh (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the first bromodomain (BD1) of human BRDT bound to NC-II-259
Assembly ID 1
Resolution 1.98Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 58
Sequence identity between the two chains 1.0
PubMed citation 35867655
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession Q58F21 Q58F21
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:7mrhA BioLiP:7mrhB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 7mrh-a1-m1-cA_7mrh-a1-m1-cB.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 7mrh-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4kcx/1/1:A/1:B 5vbr/3/1:B/1:A 7mrg/1/1:A/1:B

[Back to Home]