7mu5/1/1:G/1:A

Sequences
>7mu5-a1-m1-cG (length=104) [Search sequence]
FSFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLALVGEVGELAELFQWKTDGPQGWS
PRERAALQEELSDVLIYLVALAARCRVDLPLAVLSKMDINRRRY
>7mu5-a1-m1-cA (length=110) [Search sequence]
GRFSFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLALVGEVGELAELFQWKTDGEPG
PQGWSPRERAALQEELSDVLIYLVALAARCRVDLPLAVLSKMDINRRRYP
Structure information
PDB ID 7mu5 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Human DCTPP1 bound to Triptolide
Assembly ID 1
Resolution 2.2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 10
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID G A
UniProt accession Q9H773 Q9H773
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:7mu5G BioLiP:7mu5A
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 7mu5-a1-m1-cG_7mu5-a1-m1-cA.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 7mu5-assembly1.cif.gz

[Back to Home]