7mu5/2/1:H/1:B

Sequences

>7mu5-a2-m1-cH (length=104) [Search sequence]

FSFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLALVGEVGELAELFQWKTGPQGWSP RERAALQEELSDVLIYLVALAARCRVDLPLAVLSKMDINRRRYP

>7mu5-a2-m1-cB (length=105) [Search sequence]

RFSFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLALVGEVGELAELFQWKTGPQGWS PRERAALQEELSDVLIYLVALAARCRVDLPLAVLSKMDINRRRYP

Structure information

PDB ID	7mu5 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Human DCTPP1 bound to Triptolide
Assembly ID	2
Resolution	2.2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	51
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	H	B
UniProt accession	Q9H773	Q9H773
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:7mu5H	BioLiP:7mu5B

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 7mu5-a2-m1-cH_7mu5-a2-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 7mu5-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures	7mu5/1/1:C/1:G 7mu5/1/1:E/1:A 7mu5/2/1:D/1:F
Other dimers with similar sequences but different poses	7mu5/2/1:H/1:F 7mu5/1/1:C/1:A 7mu5/1/1:G/1:E 7mu5/2/1:B/1:D