7mu5/2/1:H/1:B

Sequences
>7mu5-a2-m1-cH (length=104) [Search sequence]
FSFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLALVGEVGELAELFQWKTGPQGWSP
RERAALQEELSDVLIYLVALAARCRVDLPLAVLSKMDINRRRYP
>7mu5-a2-m1-cB (length=105) [Search sequence]
RFSFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLALVGEVGELAELFQWKTGPQGWS
PRERAALQEELSDVLIYLVALAARCRVDLPLAVLSKMDINRRRYP
Structure information
PDB ID 7mu5 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Human DCTPP1 bound to Triptolide
Assembly ID 2
Resolution 2.2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 51
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID H B
UniProt accession Q9H773 Q9H773
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:7mu5H BioLiP:7mu5B
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 7mu5-a2-m1-cH_7mu5-a2-m1-cB.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 7mu5-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 7mu5/1/1:C/1:G 7mu5/1/1:E/1:A 7mu5/2/1:D/1:F
Other dimers with similar sequences but different poses
  • 7mu5/2/1:H/1:F 7mu5/1/1:C/1:A 7mu5/1/1:G/1:E 7mu5/2/1:B/1:D
  • [Back to Home]