7n34/1/1:A/2:A

Sequences
>7n34-a1-m1-cA (length=107) [Search sequence]
GKFLCVPNLEGRWHVDGHTRSEGGNTWEGELKIVQTWDKVRIHLKTKASHSDSVTASIIY
DKGIGYQLLYNYRNQVGFAEFRFDADLKSAEGHYFNGATYGTTITRI
>7n34-a1-m2-cA (length=107) [Search sequence]
GKFLCVPNLEGRWHVDGHTRSEGGNTWEGELKIVQTWDKVRIHLKTKASHSDSVTASIIY
DKGIGYQLLYNYRNQVGFAEFRFDADLKSAEGHYFNGATYGTTITRI
Structure information
PDB ID 7n34 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of Yersinia aleksiciae Cap15 cyclic dinucleotide receptor, crystal form 1
Assembly ID 1
Resolution 1.9Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 36
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession
Species 263819 (Yersinia aleksiciae) 263819 (Yersinia aleksiciae)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 7n34-a1-m1-cA_7n34-a1-m2-cA.pdb.gz
Full biological assembly
Download: 7n34-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 7n34/2/1:A/3:A 7n35/2/1:A/1:B
  • [Back to Home]