7n69/1/1:B/1:F

Sequences

>7n69-a1-m1-cB (length=238) [Search sequence]

YKLARPYIADCPNCGHSRCDSPIAIEEVRGDAHAGVIRIQTSAMFGLKTDGVDLAYMSFM
NGKTQKSIKIDNLHVRTSAPCSLVSHHGYYILAQCPPGDTVTVGFHDGPNRHTCTVAHKV
EFRPVGREKYRHPPEHGVELPCNRYTHKRADVPFVPVKAKCIATLAPEPLVEHKHRTLIL
HLHPDHPTLLTTRSLGSDANPTRQWIERPTTVNFTVTGEGLEYTWGNHPPKRVWAQES

>7n69-a1-m1-cF (length=238) [Search sequence]

Structure information

PDB ID	7n69 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Pre-fusion state 2 of EEEV with localized reconstruction
Assembly ID	1
Resolution	14.1Å
Method of structure determination	ELECTRON MICROSCOPY
Number of inter-chain contacts	34
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	F
UniProt accession	Q4QXJ7	Q4QXJ7
Species	374598 (Eastern equine encephalitis virus (strain Florida 91-469))	374598 (Eastern equine encephalitis virus (strain Florida 91-469))

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	7n69-a1-m1-cB_7n69-a1-m1-cF.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	7n69-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	7n69/1/1:B/1:D 7n69/1/1:D/1:F
Other dimers with similar sequences but different poses	7n69/1/1:J/1:L 7n69/1/1:H/1:J 7n69/1/1:H/1:L