7nb0/2/1:D/1:B

Sequences
>7nb0-a2-m1-cD (length=55) [Search sequence]
VTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLRTLERYQKC
>7nb0-a2-m1-cB (length=57) [Search sequence]
QVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLRTLERYQKCN
Structure information
PDB ID 7nb0 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of the DNA-binding domain of SEPALLATA 3
Assembly ID 2
Resolution 2.1Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 98
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D B
UniProt accession O22456 O22456
Species 3702 (Arabidopsis thaliana) 3702 (Arabidopsis thaliana)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 7nb0-a2-m1-cD_7nb0-a2-m1-cB.pdb.gz
Full biological assembly
Download: 7nb0-assembly2.cif.gz
Similar dimers

[Back to Home]