7nht/1/1:d/1:c

Sequences
>7nht-a1-m1-cd (length=44) [Search sequence]
EEKVREEYEEILNTKLAEQYDAFVKFTHDQIMRRYGEQPASYVS
>7nht-a1-m1-cc (length=48) [Search sequence]
LKEREEKVREEYEEILNTKLAEQYDAFVKFTHDQIMRRYGEQPASYVS
Structure information
PDB ID 7nht (database links: RCSB PDB PDBe PDBj PDBsum)
Title Akirin2 bound human proteasome
Assembly ID 1
Resolution 3.2Å
Method of structure determination ELECTRON MICROSCOPY
Number of inter-chain contacts 34
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID d c
UniProt accession Q53H80 Q53H80
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 7nht-a1-m1-cd_7nht-a1-m1-cc.pdb.gz
Full biological assembly
Download: 7nht-assembly1.cif.gz

[Back to Home]