7nnq/1/1:B/1:C

Sequences

>7nnq-a1-m1-cB (length=344) [Search sequence]

ATKVAVAGASGYAGGEILRLLLGHPAYADGRLRIGALTAATSAGSTLGEHHPHLTPLAHR
VVEPTEAAVLGGHDAVFLALPHGHSAVLAQQLSPETLIIDCGADFRLTDAAVWERFYGSS
HAGSWPYGLPELPGARDQLRGTRRIAVPGCYPTAALLALFPALAADLIEPAVTVVAVSGT
SGAGRAATTDLLGAEVIGSARAYNIAGVHRHTPEIAQGLRAVTDRDVSVSFTPVLIPASR
GILATCTARTRSPLSQLRAAYEKAYHAEPFIYLMPEGQLPRTGAVIGSNAAHIAVAVDED
AQTFVAIAAIDNLVKGTAGAAVQSMNLALGWPETDGLSVVGVAP

>7nnq-a1-m1-cC (length=344) [Search sequence]

Structure information

PDB ID	7nnq (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of Mycobacterium tuberculosis ArgC in complex with nicotinamide adenine dinucleotide phosphate (NADP+)
Assembly ID	1
Resolution	1.73Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	93
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	C
UniProt accession	P9WPZ9	P9WPZ9
Species	83332 (Mycobacterium tuberculosis H37Rv)	83332 (Mycobacterium tuberculosis H37Rv)
Function annotation	BioLiP:7nnqB	BioLiP:7nnqC

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	7nnq-a1-m1-cB_7nnq-a1-m1-cC.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	7nnq-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

2i3a/3/1:A/1:B 2i3a/3/1:C/1:D 2i3g/3/1:B/2:A 2i3g/3/2:B/1:A 2nqt/2/1:B/2:A 2nqt/2/2:B/1:A 7nni/1/1:A/1:B 7nni/1/2:A/2:B 7nnq/1/1:A/1:D 7nnr/1/1:A/1:B 7nnr/1/2:A/2:B 7not/1/1:A/1:B 7not/1/1:C/1:D 7not/2/1:E/1:F 7not/2/1:G/1:H 7nph/1/1:A/1:B 7nph/1/1:C/1:D 7nph/2/1:E/1:F 7nph/2/1:G/1:H 7npj/1/1:A/1:B 7npj/1/1:C/1:D 7npj/2/1:E/1:F 7npj/2/1:G/1:H

Other dimers with similar sequences but different poses

2i3g/3/2:B/2:A 2i3a/1/1:A/1:D 2i3a/2/1:C/1:B 2i3a/3/1:A/1:D 2i3a/3/1:C/1:B 2i3g/3/1:B/1:A 2nqt/1/1:B/1:A 2nqt/2/1:B/1:A 2nqt/2/2:B/2:A 7nni/1/1:A/2:B 7nni/1/1:B/2:A 7nnq/1/1:A/1:B 7nnq/1/1:C/1:D 7nnr/1/1:A/2:B 7nnr/1/1:B/2:A 7not/1/1:A/1:D 7not/1/1:B/1:C 7not/2/1:E/1:H 7not/2/1:F/1:G 7nph/1/1:A/1:D 7nph/1/1:B/1:C 7nph/2/1:E/1:H 7nph/2/1:F/1:G 7npj/1/1:A/1:D 7npj/1/1:B/1:C 7npj/2/1:E/1:H 7npj/2/1:F/1:G

7not/1/1:A/1:C 2i3a/3/1:A/1:C 2i3a/3/1:B/1:D 2i3a/4/1:A/1:C 2i3a/4/2:B/2:D 2i3g/3/1:A/2:A 2i3g/3/1:B/2:B 2nqt/2/1:A/2:A 2nqt/2/1:B/2:B 7nni/1/1:A/2:A 7nni/1/1:B/2:B 7nnq/1/1:A/1:C 7nnq/1/1:B/1:D 7nnr/1/1:A/2:A 7nnr/1/1:B/2:B 7not/1/1:B/1:D 7not/2/1:E/1:G 7not/2/1:F/1:H 7nph/1/1:A/1:C 7nph/1/1:B/1:D 7nph/2/1:E/1:G 7nph/2/1:F/1:H 7npj/1/1:A/1:C 7npj/1/1:B/1:D 7npj/2/1:E/1:G 7npj/2/1:F/1:H