7nx5/1/1:B/1:A

Sequences
>7nx5-a1-m1-cB (length=61) [Search sequence]
EIKRYKNRVASRKSRAKFKQLLQHYREVAAAKSSENDRLRLLLKQMCPSLDVDSIIPRTP
D
>7nx5-a1-m1-cA (length=62) [Search sequence]
MLEIKRYKNRVASRKSRAKFKQLLQHYREVAAAKSSENDRLRLLLKQMCPSLDVDSIIPR
TP
Structure information
PDB ID 7nx5 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the Epstein-Barr Virus protein ZEBRA (BZLF1, Zta) bound to a methylated DNA duplex
Assembly ID 1
Resolution 2.5Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 76
Sequence identity between the two chains 0.984
PubMed citation 34893887
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession P03206 P03206
Species 10377 (Human herpesvirus 4 strain B95-8) 10377 (Human herpesvirus 4 strain B95-8)
Function annotation BioLiP:7nx5B BioLiP:7nx5A
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 7nx5-a1-m1-cB_7nx5-a1-m1-cA.pdb.gz
Full biological assembly
Download: 7nx5-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2c9l/1/1:Z/1:Y 2c9n/1/1:Y/1:Z 5szx/1/1:A/1:B 7nx5/2/1:E/1:F

[Back to Home]