7o39/1/1:A/1:B

Sequences
>7o39-a1-m1-cA (length=51) [Search sequence]
FTPNEIKNKEFSRVKNGLEPTEVANFLEQLSTEIERLKEDKKQLEKVIEER
>7o39-a1-m1-cB (length=51) [Search sequence]
FTPNEIKNKEFSRVKNGLEPTEVANFLEQLSTEIERLKEDKKQLEKVIEER
Structure information
PDB ID 7o39 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of S. aureus DivIVA N terminal domain
Assembly ID 1
Resolution 1.3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 99
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession Q2FZ83 Q2FZ83
Species 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) 93061 (Staphylococcus aureus subsp. aureus NCTC 8325)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 7o39-a1-m1-cA_7o39-a1-m1-cB.pdb.gz
Full biological assembly
Download: 7o39-assembly1.cif.gz

[Back to Home]