7o4x/1/2:A/3:A

Sequences
>7o4x-a1-m2-cA (length=103) [Search sequence]
MKKLEITIRPENLEEVKQILSDRGVSGMTILSAMGAGNQKINLLPKIHVITYVKDHLVGN
ILIDIHERLSTGEVGDGKVIVSPLEEVMRIRTGERGENALSAW
>7o4x-a1-m3-cA (length=103) [Search sequence]
MKKLEITIRPENLEEVKQILSDRGVSGMTILSAMGAGNQKINLLPKIHVITYVKDHLVGN
ILIDIHERLSTGEVGDGKVIVSPLEEVMRIRTGERGENALSAW
Structure information
PDB ID 7o4x (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the PII-like protein PotN from Lentilactobacillus hilgardii
Assembly ID 1
Resolution 1.65Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 87
Sequence identity between the two chains 1.0
PubMed citation 35285159
Chain information
Chain 1 Chain 2
Model ID 2 3
Chain ID A A
UniProt accession A0A6P1EFQ2 A0A6P1EFQ2
Species 525310 (Lentilactobacillus hilgardii ATCC 27305) 525310 (Lentilactobacillus hilgardii ATCC 27305)
Function annotation BioLiP:7o4xA BioLiP:7o4xA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 7o4x-a1-m2-cA_7o4x-a1-m3-cA.pdb.gz
Full biological assembly
Download: 7o4x-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 7o4x/1/1:A/2:A 7o4x/1/1:A/3:A

[Back to Home]