7oa6/1/1:J/1:I

Sequences

>7oa6-a1-m1-cJ (length=116) [Search sequence]

NDLSLFPSGFGFPRSVAVPVDILDHDNNYELKVVVPGVKSKKDIDIEYHQNKNQILVSGE IPSTLNEESKDKVKVKESSSGKFKRVITLPDYPGVDADNIKADYANGVLTLTVPKL

>7oa6-a1-m1-cI (length=152) [Search sequence]

YDPRDETLDDWFDNDLSLFPSGFGFPRSVAVPVDILDHDNNYELKVVVPGVKSKKDIDIE YHQNKNQILVSGEIPSTLNEESKDKVKVKESSSGKFKRVITLPDYPGVDADNIKADYANG VLTLTVPKLKPQKDGKNHVKKIEVSSQESWGN

Structure information

PDB ID	7oa6 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Pseudo-atomic model for Hsp26 residues 63 to 214. Please be advised that the target map is not of sufficient resolution to unambiguously position backbone or side chain atoms. This model represents a likely fit.
Assembly ID	1
Resolution	7.8Å
Method of structure determination	ELECTRON MICROSCOPY
Number of inter-chain contacts	171
Sequence identity between the two chains	1.0
PubMed citation	34795272

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	J	I
UniProt accession	P15992	P15992
Species	559292 (Saccharomyces cerevisiae S288C)	559292 (Saccharomyces cerevisiae S288C)
Function annotation	BioLiP:7oa6I

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 7oa6-a1-m1-cJ_7oa6-a1-m1-cI.pdb.gz

Full biological assembly Download: 7oa6-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

7oa6/1/1:B/1:I 7oa6/1/1:X/1:B